Recombinant Human VSTM2L protein, His-tagged
Cat.No. : | VSTM2L-8555H |
Product Overview : | Recombinant Human VSTM2L protein(82-204 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 82-204 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | RSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | VSTM2L V-set and transmembrane domain containing 2 like [ Homo sapiens ] |
Official Symbol | VSTM2L |
Synonyms | VSTM2L; V-set and transmembrane domain containing 2 like; C20orf102, chromosome 20 open reading frame 102; V-set and transmembrane domain-containing protein 2-like protein; dJ1118M15.2; C20orf102; |
mRNA Refseq | NM_080607 |
Protein Refseq | NP_542174 |
UniProt ID | Q96N03 |
Gene ID | 128434 |
◆ Recombinant Proteins | ||
VSTM2L-8555H | Recombinant Human VSTM2L protein, His-tagged | +Inquiry |
VSTM2L-10791Z | Recombinant Zebrafish VSTM2L | +Inquiry |
VSTM2L-31539TH | Recombinant Human VSTM2L, His-tagged | +Inquiry |
Vstm2l-6953M | Recombinant Mouse Vstm2l Protein, Myc/DDK-tagged | +Inquiry |
VSTM2L-4992R | Recombinant Rhesus Macaque VSTM2L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSTM2L-376HCL | Recombinant Human VSTM2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSTM2L Products
Required fields are marked with *
My Review for All VSTM2L Products
Required fields are marked with *