Recombinant Human VTCN1 Protein, Biotinylated
| Cat.No. : | VTCN1-603H |
| Product Overview : | Biotinylated Recombinant human VTCN1 protein without tag was expressed in HEK293.. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Protein Length : | 282 |
| Description : | This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | Lyophilized |
| Molecular Mass : | 26.1 kDa |
| AA Sequence : | MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK |
| Purity : | > 98% |
| Applications : | WB; ELISA; FACS; FC |
| Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
| Storage : | At -20 centigrade. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
| Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
| Conjugation : | Biotin |
| Gene Name | VTCN1 V-set domain containing T cell activation inhibitor 1 [ Homo sapiens (human) ] |
| Official Symbol | VTCN1 |
| Synonyms | VTCN1; V-set domain containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; B7 family member; H4; B7 superfamily member 1; B7 H4; B7H4; B7S1; B7X; FLJ22418; B7 family member, H4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; immune costimulatory protein B7-H4; B7-H4; B7h.5; VCTN1; PRO1291; RP11-229A19.4; |
| Gene ID | 79679 |
| mRNA Refseq | NM_001253849 |
| Protein Refseq | NP_001240778 |
| MIM | 608162 |
| UniProt ID | Q7Z7D3 |
| ◆ Recombinant Proteins | ||
| VTCN1-6206R | Recombinant Rat VTCN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| VTCN1-2913C | Active Recombinant Canine VTCN1 protein, His-tagged | +Inquiry |
| Vtcn1-825MAF555 | Recombinant Mouse Vtcn1 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| VTCN1-6594H | Recombinant Human VTCN1 Protein (Arg34-Thr147), N-His tagged | +Inquiry |
| VTCN1-427HF | Recombinant Human VTCN1 Protein, His-tagged, FITC conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VTCN1-1096HCL | Recombinant Human VTCN1 cell lysate | +Inquiry |
| VTCN1-1636MCL | Recombinant Mouse VTCN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VTCN1 Products
Required fields are marked with *
My Review for All VTCN1 Products
Required fields are marked with *



