Recombinant Human VWC2 protein, GST-tagged

• Cat.No.: VWC2-301219H
• Product Overview: Recombinant Human VWC2 (28-94 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ser28-Lys94
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: SPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: VWC2 von Willebrand factor C domain containing 2 [ Homo sapiens ]
• Official Symbol: VWC2
• Synonyms: VWC2; von Willebrand factor C domain containing 2; brorin; brain specific chordin like; PSST739; UNQ739; brain-specific chordin-like protein; von Willebrand factor C domain-containing protein 2; MGC131845
• Gene ID: 375567
• mRNA Refseq: NM_198570
• Protein Refseq: NP_940972
• MIM: 611108
• UniProt ID: Q2TAL6