Recombinant Human VWC2 protein, His-tagged
| Cat.No. : | VWC2-2981H |
| Product Overview : | Recombinant Human VWC2 protein(28-94 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-94 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLK |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | VWC2 von Willebrand factor C domain containing 2 [ Homo sapiens ] |
| Official Symbol | VWC2 |
| Synonyms | VWC2; von Willebrand factor C domain containing 2; brorin; brain specific chordin like; PSST739; UNQ739; brain-specific chordin-like protein; von Willebrand factor C domain-containing protein 2; MGC131845; |
| Gene ID | 375567 |
| mRNA Refseq | NM_198570 |
| Protein Refseq | NP_940972 |
| MIM | 611108 |
| UniProt ID | Q2TAL6 |
| ◆ Recombinant Proteins | ||
| VWC2-2981H | Recombinant Human VWC2 protein, His-tagged | +Inquiry |
| VWC2-199H | Recombinant Human VWC2 protein, T7/His-tagged | +Inquiry |
| VWC2-301219H | Recombinant Human VWC2 protein, GST-tagged | +Inquiry |
| VWC2-3794H | Recombinant Human VWC2 protein(Met1-Met325), His-tagged | +Inquiry |
| VWC2-6457Z | Recombinant Zebrafish VWC2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VWC2-2150HCL | Recombinant Human VWC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VWC2 Products
Required fields are marked with *
My Review for All VWC2 Products
Required fields are marked with *
