Recombinant Human VWC2 protein, T7/His-tagged
Cat.No. : | VWC2-199H |
Product Overview : | Recombinant human VWC2 cDNA (27 -325aa, derived from BC110857) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSG RDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYP DYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGK TYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECT ICHCTYEEGTWRIERQAMCTRHECRQM |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | VWC2 von Willebrand factor C domain containing 2 [ Homo sapiens ] |
Official Symbol | VWC2 |
Synonyms | VWC2; PSST739; UNQ739; brain-specific chordin-like protein; von Willebrand factor C domain-containing protein 2; MGC131845; |
Gene ID | 375567 |
mRNA Refseq | NM_198570 |
Protein Refseq | NP_940972 |
MIM | 611108 |
UniProt ID | Q2TAL6 |
Chromosome Location | 7p12.3-p12.2 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
VWC2-3794H | Recombinant Human VWC2 protein(Met1-Met325), His-tagged | +Inquiry |
VWC2-2981H | Recombinant Human VWC2 protein, His-tagged | +Inquiry |
VWC2-301219H | Recombinant Human VWC2 protein, GST-tagged | +Inquiry |
VWC2-6457Z | Recombinant Zebrafish VWC2 | +Inquiry |
VWC2-199H | Recombinant Human VWC2 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VWC2-2150HCL | Recombinant Human VWC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VWC2 Products
Required fields are marked with *
My Review for All VWC2 Products
Required fields are marked with *
0
Inquiry Basket