Recombinant Human WBSCR22 protein, His-tagged
Cat.No. : | WBSCR22-7844H |
Product Overview : | Recombinant Human WBSCR22 protein(1-142 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-142 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAKRL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | WBSCR22 |
Synonyms | WBSCR22; Williams Beuren syndrome chromosome region 22; uncharacterized methyltransferase WBSCR22; MGC2022; MGC5140; MGC19709; PP3381; WBMT; Williams-Beuren syndrome chromosomal region 22 protein; Williams-Beuren candidate region putative methyltransferase; HUSSY-3; HASJ4442; FLJ44236; |
Gene ID | 114049 |
mRNA Refseq | NM_001202560 |
Protein Refseq | NP_001189489 |
UniProt ID | O43709 |
◆ Recombinant Proteins | ||
WBSCR22-7843H | Recombinant Human WBSCR22 protein, GST-tagged | +Inquiry |
WBSCR22-7844H | Recombinant Human WBSCR22 protein, His-tagged | +Inquiry |
WBSCR22-5264Z | Recombinant Zebrafish WBSCR22 | +Inquiry |
WBSCR22-3385C | Recombinant Chicken WBSCR22 | +Inquiry |
WBSCR22-5191R | Recombinant Rhesus monkey WBSCR22 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WBSCR22-362HCL | Recombinant Human WBSCR22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WBSCR22 Products
Required fields are marked with *
My Review for All WBSCR22 Products
Required fields are marked with *