Recombinant Human WDR1 protein(11-260 aa), N-SUMO & N-His-tagged

Cat.No. : WDR1-2482H
Product Overview : Recombinant Human WDR1 protein(O75083)(11-260 aa), fused with N-terminal SUMO tag and N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 11-260 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKI
Gene Name WDR1 WD repeat domain 1 [ Homo sapiens ]
Official Symbol WDR1
Synonyms WDR1; WD repeat domain 1; WD repeat-containing protein 1; actin-interacting protein 1; AIP1; NORI-1;
Gene ID 9948
mRNA Refseq NM_005112
Protein Refseq NP_005103
MIM 604734
UniProt ID O75083

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WDR1 Products

Required fields are marked with *

My Review for All WDR1 Products

Required fields are marked with *

0
cart-icon