"WDR82" Related Products

Expand

Recombinant Human WDR82 Protein, His-tagged

Cat.No.: WDR82-21H
Product Overview: Recombinant Human WDR82 Protein was expressed in E. coli with His tag.
Source: E. coli
Species: Human
Tag : His
Form: The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol.
Molecular Mass: 21 kDa
AA Sequence: DLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Gene Name: WDR82 WD repeat domain 82 [ Homo sapiens (human) ]
Official Symbol: WDR82
Synonyms: SWD2; MST107; WDR82A; MSTP107; PRO2730; TMEM113; PRO34047
Gene ID: 80335
mRNA Refseq: NM_025222.3
Protein Refseq: NP_079498.2
MIM: 611059
UniProt ID: Q6UXN9

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.