Recombinant Human WDR82 Protein, His-tagged
Cat.No. : | WDR82-21H |
Product Overview : | Recombinant Human WDR82 Protein was expressed in E. coli with His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol. |
Molecular Mass : | 21 kDa |
AA Sequence : | DLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Gene Name | WDR82 WD repeat domain 82 [ Homo sapiens (human) ] |
Official Symbol | WDR82 |
Synonyms | SWD2; MST107; WDR82A; MSTP107; PRO2730; TMEM113; PRO34047 |
Gene ID | 80335 |
mRNA Refseq | NM_025222.3 |
Protein Refseq | NP_079498.2 |
MIM | 611059 |
UniProt ID | Q6UXN9 |
◆ Recombinant Proteins | ||
WDR82-21H | Recombinant Human WDR82 Protein, His-tagged | +Inquiry |
WDR82-5206R | Recombinant Rhesus monkey WDR82 Protein, His-tagged | +Inquiry |
WDR82-5019R | Recombinant Rhesus Macaque WDR82 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR82-1287C | Recombinant Chicken WDR82 | +Inquiry |
WDR82-7607Z | Recombinant Zebrafish WDR82 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDR82 Products
Required fields are marked with *
My Review for All WDR82 Products
Required fields are marked with *
0
Inquiry Basket