Recombinant Human WFDC2 Protein, His-tagged
Cat.No. : | WFDC2-281H |
Product Overview : | Recombinant human WFDC2 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 124 |
Description : | This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. |
Form : | Lyophilized |
Molecular Mass : | 10.9 kDa |
AA Sequence : | MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | WFDC2 WAP four-disulfide core domain 2 [ Homo sapiens (human) ] |
Official Symbol | WFDC2 |
Synonyms | WFDC2; WAP four-disulfide core domain 2; WAP four-disulfide core domain protein 2; dJ461P17.6; EDDM4; epididymal protein 4; HE4; WAP5; epididymal secretory protein E4; putative protease inhibitor WAP5; WAP domain containing protein HE4-V4; major epididymis-specific protein E4; epididymis-specific, whey-acidic protein type, four-disulfide core; MGC57529; |
Gene ID | 10406 |
mRNA Refseq | NM_006103 |
Protein Refseq | NP_006094 |
MIM | 617548 |
UniProt ID | Q14508 |
◆ Recombinant Proteins | ||
HE4-69H | Recombinant Human HE4 | +Inquiry |
WFDC2-6743H | Recombinant Human WFDC2 protein, GST-tagged | +Inquiry |
WFDC2-361H | Recombinant Human WFDC2 Protein, MYC/DDK-tagged | +Inquiry |
WFDC2-3982H | Recombinant Human WFDC2 protein, His-tagged | +Inquiry |
WFDC2-3983H | Recombinant Human WFDC2 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC2-2056HCL | Recombinant Human WFDC2 cell lysate | +Inquiry |
WFDC2-1266CCL | Recombinant Canine WFDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WFDC2 Products
Required fields are marked with *
My Review for All WFDC2 Products
Required fields are marked with *