Recombinant Human WNT3A protein, His-tagged

• Cat.No.: WNT3A-1698H
• Product Overview: Recombinant Human WNT3A protein(19-120 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 19-120 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: SYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV

Gene Information

• Gene Name: WNT3A wingless-type MMTV integration site family, member 3A [ Homo sapiens ]
• Official Symbol: WNT3A
• Synonyms: WNT3A; wingless-type MMTV integration site family, member 3A; protein Wnt-3a; MGC119418; MGC119419; MGC119420
• Gene ID: 89780
• mRNA Refseq: NM_033131
• Protein Refseq: NP_149122
• MIM: 606359
• UniProt ID: P56704