"WNT5A" Related Products

Recombinant Human WNT5A protein, His-tagged

Cat.No.: WNT5A-1634H
Product Overview: Recombinant full length human WNT5A protein was expressed in E. coli with C-terminus his tag. This product is for the mature full length protein. The signal peptide and propeptide are not included.
Description: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants.
Source: E. coli
Species: Human
Tag : His
Form: Lyophilized
Molecular Mass: 37 kDa
AA Sequence: MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHH
Purity: >95% by SDS-PAGE
Storage: Store at -20 centigrade. Avoid freeze-thaw cycle.
Reconstitution: Reconstitute in water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions or stored at -20 centigrade.
Gene Name: Wnt family member 5A [ Homo sapiens (human) ]
Official Symbol: WNT5A
Synonyms: hWNT 5A; hWNT5A; Protein Wnt 5a; Protein Wnt-5a; Protein Wnt5a; Wingless type MMTV integration site family member 5A; Wnt 5a; WNT 5A protein; WNT 5A protein precursor; WNT5A; WNT5A protein precursor; WNT5A_HUMAN
Gene ID: 7474
mRNA Refseq: NM_003392.4
Protein Refseq: NP_003383.2
MIM: 164975
UniProt ID: P41221

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.