Recombinant Human WNT5A protein, His-tagged
Cat.No. : | WNT5A-1634H |
Product Overview : | Recombinant full length human WNT5A protein was expressed in E. coli with C-terminus his tag. This product is for the mature full length protein. The signal peptide and propeptide are not included. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants. |
Form : | Lyophilized |
Molecular Mass : | 37 kDa |
AA Sequence : | MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHH |
Purity : | >95% by SDS-PAGE |
Storage : | Store at -20 centigrade. Avoid freeze-thaw cycle. |
Reconstitution : | Reconstitute in water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions or stored at -20 centigrade. |
Full Length : | Full L. |
Gene Name | Wnt family member 5A [ Homo sapiens (human) ] |
Official Symbol | WNT5A |
Synonyms | hWNT 5A; hWNT5A; Protein Wnt 5a; Protein Wnt-5a; Protein Wnt5a; Wingless type MMTV integration site family member 5A; Wnt 5a; WNT 5A protein; WNT 5A protein precursor; WNT5A; WNT5A protein precursor; WNT5A_HUMAN |
Gene ID | 7474 |
◆ Recombinant Proteins | ||
WNT5A-18573M | Recombinant Mouse WNT5A Protein | +Inquiry |
Wnt5a-2051M | Recombinant Mouse Wingless-Related MMTV Integration Site 5A | +Inquiry |
WNT5A-3765H | Recombinant Human WNT5A Full Length protein, His-tagged | +Inquiry |
Wnt5a-7006M | Recombinant Mouse Wnt5a Protein, Myc/DDK-tagged | +Inquiry |
WNT5A-3768H | Recombinant Human WNT5A Full Length protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT5A-293HCL | Recombinant Human WNT5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT5A Products
Required fields are marked with *
My Review for All WNT5A Products
Required fields are marked with *