Recombinant Human WNT6 Protein, GST-tagged
Cat.No. : | WNT6-12H |
Product Overview : | Human WNT6 full-length ORF ( NP_006513.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | Liquid |
Molecular Mass : | 66.1 kDa |
AA Sequence : | MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | WNT6 wingless-type MMTV integration site family, member 6 [ Homo sapiens ] |
Official Symbol | WNT6 |
Synonyms | WNT6; wingless-type MMTV integration site family, member 6; protein Wnt-6 |
Gene ID | 7475 |
mRNA Refseq | NM_006522 |
Protein Refseq | NP_006513 |
MIM | 604663 |
UniProt ID | Q9Y6F9 |
◆ Recombinant Proteins | ||
WNT6-1746C | Recombinant Chicken WNT6 | +Inquiry |
WNT6-6HFL | Recombinant Full Length Human WNT6 Protein, His&GST-tagged | +Inquiry |
WNT6-12H | Recombinant Human WNT6 Protein, GST-tagged | +Inquiry |
WNT6-10200M | Recombinant Mouse WNT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT6-7H | Recombinant Human WNT6 Protein, His&ABP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT6-290HCL | Recombinant Human WNT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT6 Products
Required fields are marked with *
My Review for All WNT6 Products
Required fields are marked with *
0
Inquiry Basket