Recombinant Human WNT7B Protein (25-349 aa), His-Myc-tagged
| Cat.No. : | WNT7B-2786H |
| Product Overview : | Recombinant Human WNT7B Protein (25-349 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 25-349 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 40.2 kDa |
| AA Sequence : | ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | WNT7B wingless-type MMTV integration site family, member 7B [ Homo sapiens ] |
| Official Symbol | WNT7B |
| Synonyms | WNT7B; wingless-type MMTV integration site family, member 7B; protein Wnt-7b; |
| Gene ID | 7477 |
| mRNA Refseq | NM_058238 |
| Protein Refseq | NP_478679 |
| MIM | 601967 |
| UniProt ID | P56706 |
| ◆ Recombinant Proteins | ||
| WNT7B-3291C | Recombinant Chicken WNT7B | +Inquiry |
| WNT7B-2291H | Recombinant Human WNT7B Protein (25-349 aa), His-SUMO-Myc-tagged | +Inquiry |
| WNT7B-2310M | Recombinant Mouse WNT7B Protein (25-349 aa), His-SUMO-Myc-tagged | +Inquiry |
| WNT7B-241H | Recombinant Human WNT7B protein, StrepII/His-tagged | +Inquiry |
| WNT7B-4053C | Recombinant Chicken WNT7B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WNT7B-288HCL | Recombinant Human WNT7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT7B Products
Required fields are marked with *
My Review for All WNT7B Products
Required fields are marked with *



