Recombinant Human XAF1 Protein, GST-tagged

Cat.No. : XAF1-227H
Product Overview : Human BIRC4BP partial ORF ( NP_059993.2, 202 a.a. - 301 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; MIM 600636). XIAP has 3 BIR domains and a C-terminal RING zinc finger that possesses E3 ubiquitin ligase (see MIM 601623) activity. XAF1 antagonizes the anticaspase activity of XIAP and may be important in mediating apoptosis resistance in cancer cells (Liston et al., 2001 [PubMed 11175744]).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : QTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name XAF1 XIAP associated factor 1 [ Homo sapiens ]
Official Symbol XAF1
Synonyms XAF1; XIAP associated factor 1; XIAP-associated factor 1; BIRC4BP; HSXIAPAF1; XIAPAF1; BIRC4 binding protein; BIRC4-binding protein;
Gene ID 54739
mRNA Refseq NM_017523
Protein Refseq NP_059993
MIM 606717
UniProt ID Q6GPH4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XAF1 Products

Required fields are marked with *

My Review for All XAF1 Products

Required fields are marked with *

0
cart-icon