Recombinant Human XCL1 Protein, His-tagged
| Cat.No. : | XCL1-01H |
| Product Overview : | Recombinant Human XCL1 Protein, His-tagged, expressed in HEK293. |
| Availability | December 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 22-114 aa |
| Tag : | C-His |
| Molecular Mass : | 11 kDa |
| AA Sequence : | VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTGHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| GeneID : | 6375 |
| Gene Name | XCL1 X-C motif chemokine ligand 1 [ Homo sapiens (human) ] |
| Official Symbol | XCL1 |
| Synonyms | LTN,ATAC,LPTN,SCM1,SCM-1,SCM1A,SCYC1,SCM-1a,XCL1 |
| mRNA Refseq | NM_002995 |
| Protein Refseq | NP_002986 |
| MIM | 600250 |
| UniProt ID | P47992 |
| ◆ Recombinant Proteins | ||
| XCL1-06H | Recombinant Human XCL1 protein, His/Fc-tagged | +Inquiry |
| XCL1-6603C | Recombinant Chicken XCL1 | +Inquiry |
| XCL1-6245H | Recombinant Human XCL1 Protein (Ser27-Asn107), His tagged | +Inquiry |
| XCL1-159H | Active Recombinant Human XCL1, HIgG1 Fc-tagged, mutant | +Inquiry |
| XCL1-1187C | Recombinant Cynomolgus XCL1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| XCL1-466HCL | Recombinant Human XCL1 cell lysate | +Inquiry |
| XCL1-480MCL | Recombinant Mouse XCL1 cell lysate | +Inquiry |
| XCL1-452CCL | Recombinant Cynomolgus XCL1 cell lysate | +Inquiry |
| XCL1-001CCL | Recombinant Canine XCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XCL1 Products
Required fields are marked with *
My Review for All XCL1 Products
Required fields are marked with *
