Recombinant Human XCL1 Protein, His-tagged
Cat.No. : | XCL1-01H |
Product Overview : | Recombinant Human XCL1 Protein, His-tagged, expressed in HEK293. |
Availability | May 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-114 aa |
Tag : | C-His |
Molecular Mass : | 11 kDa |
AA Sequence : | VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTGHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
GeneID : | 6375 |
Gene Name | XCL1 X-C motif chemokine ligand 1 [ Homo sapiens (human) ] |
Official Symbol | XCL1 |
Synonyms | LTN,ATAC,LPTN,SCM1,SCM-1,SCM1A,SCYC1,SCM-1a,XCL1 |
mRNA Refseq | NM_002995 |
Protein Refseq | NP_002986 |
MIM | 600250 |
UniProt ID | P47992 |
◆ Recombinant Proteins | ||
XCL1-05H | Recombinant Human XCL1 protein | +Inquiry |
XCL1-6264R | Recombinant Rat XCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Xcl1-7708R | Recombinant Rat Xcl1 protein, His & GST-tagged | +Inquiry |
XCL1-084X | Active Recombinant Human XCL1 Protein (92 aa) | +Inquiry |
XCL1-158H | Recombinant Human Lymphotactin, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XCL1-480MCL | Recombinant Mouse XCL1 cell lysate | +Inquiry |
XCL1-466HCL | Recombinant Human XCL1 cell lysate | +Inquiry |
XCL1-001CCL | Recombinant Canine XCL1 cell lysate | +Inquiry |
XCL1-452CCL | Recombinant Cynomolgus XCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XCL1 Products
Required fields are marked with *
My Review for All XCL1 Products
Required fields are marked with *
0
Inquiry Basket