Recombinant Human XRCC5 protein, His&Myc-tagged
Cat.No. : | XRCC5-3774H |
Product Overview : | Recombinant Human XRCC5 protein(P13010)(251-455aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 251-455aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.4 kDa |
AA Sequence : | LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ] |
Official Symbol | XRCC5 |
Synonyms | XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross-complementing protein 5; KARP 1; Ku autoantigen; 80kDa; KU80; Ku86; KUB2; TLAA; CTC85; CTCBF; nuclear factor IV; Ku autoantigen, 80kDa; DNA repair protein XRCC5; thyroid-lupus autoantigen; 86 kDa subunit of Ku antigen; lupus Ku autoantigen protein p86; Ku86 autoantigen related protein 1; CTC box-binding factor 85 kDa subunit; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; NFIV; KARP1; KARP-1; FLJ39089; |
Gene ID | 7520 |
mRNA Refseq | NM_021141 |
Protein Refseq | NP_066964 |
MIM | 194364 |
UniProt ID | P13010 |
◆ Recombinant Proteins | ||
XRCC5-18639M | Recombinant Mouse XRCC5 Protein | +Inquiry |
XRCC5-5233R | Recombinant Rhesus monkey XRCC5 Protein, His-tagged | +Inquiry |
XRCC5-1549H | Recombinant Human XRCC5 protein | +Inquiry |
XRCC5-2646H | Recombinant Human XRCC5 protein(571-730 aa), C-His-tagged | +Inquiry |
Xrcc5-8229M | Recombinant Mouse Xrcc5 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XRCC5-254HCL | Recombinant Human XRCC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XRCC5 Products
Required fields are marked with *
My Review for All XRCC5 Products
Required fields are marked with *