Recombinant Human XRCC5 protein, His&Myc-tagged

Cat.No. : XRCC5-3774H
Product Overview : Recombinant Human XRCC5 protein(P13010)(251-455aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 251-455aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.4 kDa
AA Sequence : LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) [ Homo sapiens ]
Official Symbol XRCC5
Synonyms XRCC5; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining; Ku autoantigen, 80kD); X-ray repair cross-complementing protein 5; KARP 1; Ku autoantigen; 80kDa; KU80; Ku86; KUB2; TLAA; CTC85; CTCBF; nuclear factor IV; Ku autoantigen, 80kDa; DNA repair protein XRCC5; thyroid-lupus autoantigen; 86 kDa subunit of Ku antigen; lupus Ku autoantigen protein p86; Ku86 autoantigen related protein 1; CTC box-binding factor 85 kDa subunit; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; NFIV; KARP1; KARP-1; FLJ39089;
Gene ID 7520
mRNA Refseq NM_021141
Protein Refseq NP_066964
MIM 194364
UniProt ID P13010

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XRCC5 Products

Required fields are marked with *

My Review for All XRCC5 Products

Required fields are marked with *

0
cart-icon