Recombinant Human YAP1 protein, GST-tagged
| Cat.No. : | YAP1-18H |
| Product Overview : | Recombinant Human YAP1(1 a.a. - 504 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-504 a.a. |
| Description : | This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 80.9 kDa |
| AA Sequence : | MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNP KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSG PAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMM NSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELR TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPG TNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | YAP1 Yes-associated protein 1 [ Homo sapiens ] |
| Official Symbol | YAP1 |
| Synonyms | YAP1; Yes-associated protein 1; Yes associated protein 1, 65kDa; yorkie homolog; YAP65; yes-associated protein 2; yes-associated protein beta; yes-associated protein delta; 65 kDa Yes-associated protein; YAP; YKI; YAP2; |
| Gene ID | 10413 |
| mRNA Refseq | NM_001130145 |
| Protein Refseq | NP_001123617 |
| MIM | 606608 |
| UniProt ID | P46937 |
| Chromosome Location | 11q13 |
| Pathway | ErbB4 signaling events, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene ex |
| Function | protein binding; transcription coactivator activity; transcription corepressor activity; transcription regulatory region DNA binding; |
| ◆ Recombinant Proteins | ||
| YAP1-9292HFL | Recombinant Full Length Human YAP1 protein, Flag-tagged | +Inquiry |
| Yap1-7027M | Recombinant Mouse Yap1 Protein, Myc/DDK-tagged | +Inquiry |
| YAP1-33H | Recombinant Human YAP1 protein, GST-tagged | +Inquiry |
| YAP1-32H | Recombinant Human YAP1 protein, His-tagged | +Inquiry |
| YAP1-3761H | Recombinant Human YAP1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YAP1-250HCL | Recombinant Human YAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YAP1 Products
Required fields are marked with *
My Review for All YAP1 Products
Required fields are marked with *
