Recombinant Human YAP1 protein, GST-tagged

Cat.No. : YAP1-18H
Product Overview : Recombinant Human YAP1(1 a.a. - 504 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-504 a.a.
Description : This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 80.9 kDa
AA Sequence : MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNP KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSG PAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMM NSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELR TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPG TNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name YAP1 Yes-associated protein 1 [ Homo sapiens ]
Official Symbol YAP1
Synonyms YAP1; Yes-associated protein 1; Yes associated protein 1, 65kDa; yorkie homolog; YAP65; yes-associated protein 2; yes-associated protein beta; yes-associated protein delta; 65 kDa Yes-associated protein; YAP; YKI; YAP2;
Gene ID 10413
mRNA Refseq NM_001130145
Protein Refseq NP_001123617
MIM 606608
UniProt ID P46937
Chromosome Location 11q13
Pathway ErbB4 signaling events, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Nuclear signaling by ERBB4, organism-specific biosystem;
Function protein binding; transcription coactivator activity; transcription corepressor activity; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YAP1 Products

Required fields are marked with *

My Review for All YAP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon