Recombinant Human YAP1 protein, His-tagged
Cat.No. : | YAP1-32H |
Product Overview : | Recombinant Human YAP1 protein(206-379 aa), fused with His Tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 206-379 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | YAP1 Yes-associated protein 1 [ Homo sapiens ] |
Official Symbol | YAP1 |
Synonyms | YAP1; Yes-associated protein 1; Yes associated protein 1, 65kDa; yorkie homolog; YAP65; yes-associated protein 2; yes-associated protein beta; yes-associated protein delta; 65 kDa Yes-associated protein; YAP; YKI; YAP2 |
Gene ID | 10413 |
mRNA Refseq | NM_001130145 |
Protein Refseq | NP_001123617 |
MIM | 606608 |
UniProt ID | P46937 |
◆ Recombinant Proteins | ||
YAP1-3775H | Recombinant Human YAP1 protein, His-B2M-tagged | +Inquiry |
YAP1-19H | Recombinant Human YAP1 protein, MYC/DDK-tagged | +Inquiry |
YAP1-33H | Recombinant Human YAP1 protein, GST-tagged | +Inquiry |
YAP1-10247M | Recombinant Mouse YAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YAP1-9292HFL | Recombinant Full Length Human YAP1 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YAP1-250HCL | Recombinant Human YAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YAP1 Products
Required fields are marked with *
My Review for All YAP1 Products
Required fields are marked with *