Recombinant Human YAP1 protein, His-B2M-tagged
| Cat.No. : | YAP1-3775H |
| Product Overview : | Recombinant Human YAP1 protein(P46937)(1-504aa), fused to N-terminal His-B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 1-504aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 68.5 kDa |
| AA Sequence : | MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | YAP1 Yes-associated protein 1 [ Homo sapiens ] |
| Official Symbol | YAP1 |
| Synonyms | YAP1; Yes-associated protein 1; Yes associated protein 1, 65kDa; yorkie homolog; YAP65; yes-associated protein 2; yes-associated protein beta; yes-associated protein delta; 65 kDa Yes-associated protein; YAP; YKI; YAP2; |
| Gene ID | 10413 |
| mRNA Refseq | NM_001130145 |
| Protein Refseq | NP_001123617 |
| MIM | 606608 |
| UniProt ID | P46937 |
| ◆ Recombinant Proteins | ||
| YAP1-18H | Recombinant Human YAP1 protein, GST-tagged | +Inquiry |
| YAP1-31H | Recombinant Human YAP1 protein, His-tagged | +Inquiry |
| YAP1-10247M | Recombinant Mouse YAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| YAP1-1556H | Recombinant Human YAP1 Protein (1-504 aa), His-tagged | +Inquiry |
| YAP1-33H | Recombinant Human YAP1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YAP1-250HCL | Recombinant Human YAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YAP1 Products
Required fields are marked with *
My Review for All YAP1 Products
Required fields are marked with *
