Recombinant Human YBX1, GST-tagged
| Cat.No. : | YBX1-4838H |
| Product Overview : | Recombinant Human YBX1(51 a.a. - 139 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 51-139 aa |
| Description : | Y box binding protein 1 also known as Y-box transcription factor or nuclease-sensitive element-binding protein 1 is a protein that in humans is encoded by the YBX1 gene. |
| Molecular Mass : | 35.53 kDa |
| AA Sequence : | DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANV TGPGGVPVQGSKYA |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | YBX1 Y box binding protein 1 [ Homo sapiens ] |
| Official Symbol | YBX1 |
| Synonyms | YBX1; Y box binding protein 1; NSEP1, nuclease sensitive element binding protein 1; nuclease-sensitive element-binding protein 1; BP 8; CSDA2; CSDB; DBPB; MDR NF1; NSEP 1; YB 1; YB1; CBF-A; EFI-A; DNA-binding protein B; Y-box-binding protein 1; Y-box transcription factor; enhancer factor I subunit A; nuclease sensitive element binding protein 1; CCAAT-binding transcription factor I subunit A; major histocompatibility complex, class II, Y box-binding protein I; BP-8; YB-1; NSEP1; NSEP-1; MDR-NF1; MGC104858; MGC110976; MGC117250 |
| Gene ID | 4904 |
| mRNA Refseq | NM_004559 |
| Protein Refseq | NP_004550 |
| MIM | 154030 |
| UniProt ID | P67809 |
| Chromosome Location | 1p34 |
| Pathway | Gene Expression; Processing of Capped Intron-Containing Pre-mRNA; SIDS Susceptibility Pathways |
| Function | DNA binding; RNA binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; single-stranded DNA binding |
| ◆ Recombinant Proteins | ||
| YBX1-30136TH | Recombinant Human YBX1, His-tagged | +Inquiry |
| YBX1-553HF | Recombinant Full Length Human YBX1 Protein, GST-tagged | +Inquiry |
| YBX1-637H | Recombinant Human YBX1 protein, His-tagged | +Inquiry |
| YBX1-4839H | Recombinant Human YBX1, GST-tagged | +Inquiry |
| Ybx1-7029M | Recombinant Mouse Ybx1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YBX1-1945HCL | Recombinant Human YBX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YBX1 Products
Required fields are marked with *
My Review for All YBX1 Products
Required fields are marked with *
