Recombinant Human YBX1, GST-tagged
Cat.No. : | YBX1-4838H |
Product Overview : | Recombinant Human YBX1(51 a.a. - 139 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 51-139 aa |
Description : | Y box binding protein 1 also known as Y-box transcription factor or nuclease-sensitive element-binding protein 1 is a protein that in humans is encoded by the YBX1 gene. |
Molecular Mass : | 35.53 kDa |
AA Sequence : | DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANV TGPGGVPVQGSKYA |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | YBX1 Y box binding protein 1 [ Homo sapiens ] |
Official Symbol | YBX1 |
Synonyms | YBX1; Y box binding protein 1; NSEP1, nuclease sensitive element binding protein 1; nuclease-sensitive element-binding protein 1; BP 8; CSDA2; CSDB; DBPB; MDR NF1; NSEP 1; YB 1; YB1; CBF-A; EFI-A; DNA-binding protein B; Y-box-binding protein 1; Y-box transcription factor; enhancer factor I subunit A; nuclease sensitive element binding protein 1; CCAAT-binding transcription factor I subunit A; major histocompatibility complex, class II, Y box-binding protein I; BP-8; YB-1; NSEP1; NSEP-1; MDR-NF1; MGC104858; MGC110976; MGC117250 |
Gene ID | 4904 |
mRNA Refseq | NM_004559 |
Protein Refseq | NP_004550 |
MIM | 154030 |
UniProt ID | P67809 |
Chromosome Location | 1p34 |
Pathway | Gene Expression; Processing of Capped Intron-Containing Pre-mRNA; SIDS Susceptibility Pathways |
Function | DNA binding; RNA binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding transcription factor activity; single-stranded DNA binding |
◆ Recombinant Proteins | ||
YBX1-4852H | Recombinant Human YBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YBX1-636H | Recombinant Human Y box binding protein 1, His-tagged | +Inquiry |
YBX1-10250M | Recombinant Mouse YBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YBX1-30136TH | Recombinant Human YBX1, His-tagged | +Inquiry |
YBX1-3763H | Recombinant Human YBX1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YBX1-1945HCL | Recombinant Human YBX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YBX1 Products
Required fields are marked with *
My Review for All YBX1 Products
Required fields are marked with *
0
Inquiry Basket