Recombinant Human YPEL1 Protein (1-119 aa), His-SUMO-tagged
| Cat.No. : | YPEL1-849H |
| Product Overview : | Recombinant Human YPEL1 Protein (1-119 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-119 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 29.6 kDa |
| AA Sequence : | MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | YPEL1 yippee like 1 [ Homo sapiens (human) ] |
| Official Symbol | YPEL1 |
| Synonyms | FKSG3; |
| Gene ID | 29799 |
| mRNA Refseq | NM_013313 |
| Protein Refseq | NP_037445 |
| UniProt ID | O60688 |
| ◆ Recombinant Proteins | ||
| YPEL1-1113Z | Recombinant Zebrafish YPEL1 | +Inquiry |
| YPEL1-3086H | Recombinant Human YPEL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| YPEL1-849H | Recombinant Human YPEL1 Protein (1-119 aa), His-SUMO-tagged | +Inquiry |
| Ypel1-297M | Recombinant Mouse Ypel1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YPEL1-241HCL | Recombinant Human YPEL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YPEL1 Products
Required fields are marked with *
My Review for All YPEL1 Products
Required fields are marked with *
