Recombinant Human YPEL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : YPEL1-3086H
Product Overview : YPEL1 MS Standard C13 and N15-labeled recombinant protein (NP_037445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is located in the region associated with DiGeorge syndrome on chromosome 22. The encoded protein localizes to the centrosome and nucleolus and may play a role in the regulation of cell division.
Molecular Mass : 13.6 kDa
AA Sequence : MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name YPEL1 yippee like 1 [ Homo sapiens (human) ]
Official Symbol YPEL1
Synonyms YPEL1; yippee like 1; FKSG3; protein yippee-like 1; DiGeorge syndrome-related protein
Gene ID 29799
mRNA Refseq NM_013313
Protein Refseq NP_037445
MIM 608082
UniProt ID O60688

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YPEL1 Products

Required fields are marked with *

My Review for All YPEL1 Products

Required fields are marked with *

0
cart-icon