Recombinant Human YPEL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | YPEL1-3086H |
Product Overview : | YPEL1 MS Standard C13 and N15-labeled recombinant protein (NP_037445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is located in the region associated with DiGeorge syndrome on chromosome 22. The encoded protein localizes to the centrosome and nucleolus and may play a role in the regulation of cell division. |
Molecular Mass : | 13.6 kDa |
AA Sequence : | MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | YPEL1 yippee like 1 [ Homo sapiens (human) ] |
Official Symbol | YPEL1 |
Synonyms | YPEL1; yippee like 1; FKSG3; protein yippee-like 1; DiGeorge syndrome-related protein |
Gene ID | 29799 |
mRNA Refseq | NM_013313 |
Protein Refseq | NP_037445 |
MIM | 608082 |
UniProt ID | O60688 |
◆ Recombinant Proteins | ||
YPEL1-849H | Recombinant Human YPEL1 Protein (1-119 aa), His-SUMO-tagged | +Inquiry |
YPEL1-1113Z | Recombinant Zebrafish YPEL1 | +Inquiry |
YPEL1-3086H | Recombinant Human YPEL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ypel1-297M | Recombinant Mouse Ypel1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YPEL1-241HCL | Recombinant Human YPEL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YPEL1 Products
Required fields are marked with *
My Review for All YPEL1 Products
Required fields are marked with *
0
Inquiry Basket