Recombinant Human YWHAE protein, His-tagged
| Cat.No. : | YWHAE-2595H |
| Product Overview : | Recombinant Human YWHAE protein(1-255 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 12, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-255 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | YWHAE tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide [ Homo sapiens ] |
| Official Symbol | YWHAE |
| Synonyms | YWHAE; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide; 14-3-3 protein epsilon; 14 3 3 epsilon; FLJ45465; 14-3-3 epsilon; protein kinase C inhibitor protein-1; mitochondrial import stimulation factor L subunit; tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide; MDS; MDCR; KCIP-1; 14-3-3E; FLJ53559; |
| Gene ID | 7531 |
| mRNA Refseq | NM_006761 |
| Protein Refseq | NP_006752 |
| MIM | 605066 |
| UniProt ID | P62258 |
| ◆ Recombinant Proteins | ||
| YWHAE-18683M | Recombinant Mouse YWHAE Protein | +Inquiry |
| YWHAE-4896H | Recombinant Human Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, Epsilon Polypeptide | +Inquiry |
| YWHAE-7821H | Recombinant Human YWHAE protein, His-tagged | +Inquiry |
| YWHAE-1093C | Recombinant Cynomolgus YWHAE Protein, His-tagged | +Inquiry |
| YWHAE-6294R | Recombinant Rat YWHAE Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YWHAE-740HCL | Recombinant Human YWHAE lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YWHAE Products
Required fields are marked with *
My Review for All YWHAE Products
Required fields are marked with *
