Recombinant Human YWHAQ Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | YWHAQ-4572H |
Product Overview : | YWHAQ MS Standard C13 and N15-labeled recombinant protein (NP_006817) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. |
Molecular Mass : | 27.8 kDa |
AA Sequence : | MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | YWHAQ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [ Homo sapiens (human) ] |
Official Symbol | YWHAQ |
Synonyms | YWHAQ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; 14-3-3 protein theta; 14 3 3; HS1; protein tau; 14-3-3 protein tau; 14-3-3 protein T-cell; 1C5; 14-3-3; |
Gene ID | 10971 |
mRNA Refseq | NM_006826 |
Protein Refseq | NP_006817 |
MIM | 609009 |
UniProt ID | P27348 |
◆ Recombinant Proteins | ||
YWHAQ-6641R | Recombinant Rat YWHAQ Protein | +Inquiry |
YWHAQ-6297R | Recombinant Rat YWHAQ Protein, His (Fc)-Avi-tagged | +Inquiry |
YWHAQ-4572H | Recombinant Human YWHAQ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ywhaq-7043M | Recombinant Mouse Ywhaq Protein, Myc/DDK-tagged | +Inquiry |
YWHAQ-13H | Recombinant Human Tyrosine 3-monooxygenase/ Tryptophan 5-monooxygenase Activation Protein, Theta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
YWHAQ-230HCL | Recombinant Human YWHAQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YWHAQ Products
Required fields are marked with *
My Review for All YWHAQ Products
Required fields are marked with *
0
Inquiry Basket