Recombinant Human ZBTB16 protein, His-tagged
Cat.No. : | ZBTB16-6744H |
Product Overview : | Recombinant Human ZBTB16 protein(553-673 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 553-673 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | SCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ZBTB16 zinc finger and BTB domain containing 16 [ Homo sapiens ] |
Official Symbol | ZBTB16 |
Synonyms | ZBTB16; zinc finger and BTB domain containing 16; zinc finger protein 145 (Kruppel like, expressed in promyelocytic leukemia) , ZNF145; zinc finger and BTB domain-containing protein 16; PLZF; zinc finger protein PLZF; zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia); ZNF145; |
Gene ID | 7704 |
mRNA Refseq | NM_001018011 |
Protein Refseq | NP_001018011 |
MIM | 176797 |
UniProt ID | Q05516 |
◆ Recombinant Proteins | ||
ZBTB16-2383H | Recombinant Human ZBTB16 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB16-001H | Recombinant Human ZBTB16 Protein, His tagged | +Inquiry |
ZBTB16-6744H | Recombinant Human ZBTB16 protein, His-tagged | +Inquiry |
Zbtb16-7049M | Recombinant Mouse Zbtb16 Protein, Myc/DDK-tagged | +Inquiry |
ZBTB16-5066R | Recombinant Rhesus Macaque ZBTB16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB16-741HCL | Recombinant Human ZBTB16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB16 Products
Required fields are marked with *
My Review for All ZBTB16 Products
Required fields are marked with *