Recombinant Full Length Human ZBTB16 Protein, C-Flag-tagged
Cat.No. : | ZBTB16-706HFL |
Product Overview : | Recombinant Full Length Human ZBTB16 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 74.1 kDa |
AA Sequence : | MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNSQHY TLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADG GAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIG QSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGP GTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPS SVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAV FCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDEST LKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPY QCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Acute myeloid leukemia, Pathways in cancer |
Full Length : | Full L. |
Gene Name | ZBTB16 zinc finger and BTB domain containing 16 [ Homo sapiens (human) ] |
Official Symbol | ZBTB16 |
Synonyms | PLZF; ZNF145 |
Gene ID | 7704 |
mRNA Refseq | NM_006006.6 |
Protein Refseq | NP_005997.2 |
MIM | 176797 |
UniProt ID | Q05516 |
◆ Recombinant Proteins | ||
ZBTB16-001H | Recombinant Human ZBTB16 Protein, His tagged | +Inquiry |
ZBTB16-2383H | Recombinant Human ZBTB16 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB16-3639H | Recombinant Human ZBTB16 protein, His-tagged | +Inquiry |
ZBTB16-706HFL | Recombinant Full Length Human ZBTB16 Protein, C-Flag-tagged | +Inquiry |
ZBTB16-5066R | Recombinant Rhesus Macaque ZBTB16 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB16-741HCL | Recombinant Human ZBTB16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZBTB16 Products
Required fields are marked with *
My Review for All ZBTB16 Products
Required fields are marked with *
0
Inquiry Basket