Recombinant Human ZCCHC17 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ZCCHC17-6036H |
| Product Overview : | ZCCHC17 MS Standard C13 and N15-labeled recombinant protein (NP_057589) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ZCCHC17 (Zinc Finger CCHC-Type Containing 17) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. |
| Molecular Mass : | 27.6 kDa |
| AA Sequence : | MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ZCCHC17 zinc finger CCHC-type containing 17 [ Homo sapiens (human) ] |
| Official Symbol | ZCCHC17 |
| Synonyms | ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D; nucleolar protein 40; pnn-interacting nucleolar protein; putative S1 RNA binding domain protein; putative S1 RNA-binding domain protein; zinc finger CCHC domain-containing protein 17; RP11-266K22.1; |
| Gene ID | 51538 |
| mRNA Refseq | NM_016505 |
| Protein Refseq | NP_057589 |
| UniProt ID | Q9NP64 |
| ◆ Recombinant Proteins | ||
| ZCCHC17-31652TH | Recombinant Human ZCCHC17, His-tagged | +Inquiry |
| ZCCHC17-6036H | Recombinant Human ZCCHC17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ZCCHC17-838C | Recombinant Cynomolgus Monkey ZCCHC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZCCHC17-1095C | Recombinant Cynomolgus ZCCHC17 Protein, His-tagged | +Inquiry |
| ZCCHC17-7101C | Recombinant Chicken ZCCHC17 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZCCHC17-202HCL | Recombinant Human ZCCHC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZCCHC17 Products
Required fields are marked with *
My Review for All ZCCHC17 Products
Required fields are marked with *
