Recombinant Human ZCCHC17 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZCCHC17-6036H
Product Overview : ZCCHC17 MS Standard C13 and N15-labeled recombinant protein (NP_057589) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ZCCHC17 (Zinc Finger CCHC-Type Containing 17) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding.
Molecular Mass : 27.6 kDa
AA Sequence : MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZCCHC17 zinc finger CCHC-type containing 17 [ Homo sapiens (human) ]
Official Symbol ZCCHC17
Synonyms ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D; nucleolar protein 40; pnn-interacting nucleolar protein; putative S1 RNA binding domain protein; putative S1 RNA-binding domain protein; zinc finger CCHC domain-containing protein 17; RP11-266K22.1;
Gene ID 51538
mRNA Refseq NM_016505
Protein Refseq NP_057589
UniProt ID Q9NP64

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZCCHC17 Products

Required fields are marked with *

My Review for All ZCCHC17 Products

Required fields are marked with *

0
cart-icon