Recombinant Human ZMAT4 protein, His-tagged
Cat.No. : | ZMAT4-3888H |
Product Overview : | Recombinant Human ZMAT4 protein(105 - 153 aa), fused to His tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Protein Length : | 105 - 153 aa |
AA Sequence : | LLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | ZMAT4 zinc finger, matrin-type 4 [ Homo sapiens ] |
Official Symbol : | ZMAT4 |
Synonyms : | ZMAT4; zinc finger, matrin-type 4; zinc finger matrin-type protein 4; FLJ13842; zinc finger, matrin type 4; |
Gene ID : | 79698 |
mRNA Refseq : | NM_001135731 |
Protein Refseq : | NP_001129203 |
UniProt ID : | Q9H898 |
Products Types
◆ Recombinant Protein | ||
Zmat4-7116M | Recombinant Mouse Zmat4 Protein, Myc/DDK-tagged | +Inquiry |
ZMAT4-841C | Recombinant Cynomolgus Monkey ZMAT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMAT4-10388M | Recombinant Mouse ZMAT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMAT4-1099C | Recombinant Cynomolgus ZMAT4 Protein, His-tagged | +Inquiry |
ZMAT4-301228H | Recombinant Human ZMAT4 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
ZMAT4-156HCL | Recombinant Human ZMAT4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket