Recombinant Human ZNF12 protein, GST-tagged

• Cat.No.: ZNF12-5733H
• Product Overview: Recombinant Human ZNF12 protein(93-156 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 93-156 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: QEEENKPSRQTVFIETLIEERGNVPGKTFDVETNPVPSRKIAYKNSLCDSCEKCLTSVSEYISS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: ZNF12 zinc finger protein 12 [ Homo sapiens ]
• Official Symbol: ZNF12
• Synonyms: ZNF12; zinc finger protein 12; zinc finger protein 325 , ZNF325; GIOT 3; KOX3; zinc finger protein 11; zinc finger protein 325; zinc finger protein KOX3; gonadotropin inducible transcription repressor 3; gonadotropin-inducible ovary transcription repressor 3; HZF11; GIOT-3; ZNF325
• Gene ID: 7559
• mRNA Refseq: NM_006956
• Protein Refseq: NP_008887
• MIM: 194536
• UniProt ID: P17014