Recombinant Human ZNF12 protein, GST-tagged
Cat.No. : | ZNF12-5733H |
Product Overview : | Recombinant Human ZNF12 protein(93-156 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 93-156 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | QEEENKPSRQTVFIETLIEERGNVPGKTFDVETNPVPSRKIAYKNSLCDSCEKCLTSVSEYISS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ZNF12 zinc finger protein 12 [ Homo sapiens ] |
Official Symbol | ZNF12 |
Synonyms | ZNF12; zinc finger protein 12; zinc finger protein 325 , ZNF325; GIOT 3; KOX3; zinc finger protein 11; zinc finger protein 325; zinc finger protein KOX3; gonadotropin inducible transcription repressor 3; gonadotropin-inducible ovary transcription repressor 3; HZF11; GIOT-3; ZNF325; |
Gene ID | 7559 |
mRNA Refseq | NM_006956 |
Protein Refseq | NP_008887 |
MIM | 194536 |
UniProt ID | P17014 |
◆ Recombinant Proteins | ||
ZNF12-3815H | Recombinant Human ZNF12, His-tagged | +Inquiry |
ZNF12-5733H | Recombinant Human ZNF12 protein, GST-tagged | +Inquiry |
ZFP12-18827M | Recombinant Mouse ZFP12 Protein | +Inquiry |
ZNF12-10397M | Recombinant Mouse ZNF12 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF12 Products
Required fields are marked with *
My Review for All ZNF12 Products
Required fields are marked with *