Recombinant Human ZNF12 protein, GST-tagged

Cat.No. : ZNF12-5733H
Product Overview : Recombinant Human ZNF12 protein(93-156 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 93-156 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : QEEENKPSRQTVFIETLIEERGNVPGKTFDVETNPVPSRKIAYKNSLCDSCEKCLTSVSEYISS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name ZNF12 zinc finger protein 12 [ Homo sapiens ]
Official Symbol ZNF12
Synonyms ZNF12; zinc finger protein 12; zinc finger protein 325 , ZNF325; GIOT 3; KOX3; zinc finger protein 11; zinc finger protein 325; zinc finger protein KOX3; gonadotropin inducible transcription repressor 3; gonadotropin-inducible ovary transcription repressor 3; HZF11; GIOT-3; ZNF325;
Gene ID 7559
mRNA Refseq NM_006956
Protein Refseq NP_008887
MIM 194536
UniProt ID P17014

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF12 Products

Required fields are marked with *

My Review for All ZNF12 Products

Required fields are marked with *

0
cart-icon
0
compare icon