Recombinant Human ZNF281 Protein, His-tagged
Cat.No. : | ZNF281-138H |
Product Overview : | Recombinant Human ZNF281 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of gene expression; negative regulation of transcription by RNA polymerase II; and positive regulation of transcription, DNA-templated. Located in nucleoplasm. |
Form : | Lyophilized from 0.22 um filtered solution in 50mM Tris, 300mM NaCl, pH8.5. |
Molecular Mass : | 27.4 kDa |
AA Sequence : | MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYLLEHHHHHH |
Purity : | >90% |
Storage : | For long term storage, the product should be stored at lyophilized state at -20 centigrade or lower. Please avoid repeated freeze-thaw cycles. |
Concentration : | 8.7mg/mL |
Gene Name | ZNF281 zinc finger protein 281 [ Homo sapiens (human) ] |
Official Symbol | ZNF281 |
Synonyms | GZP1; ZBP99; ZBP-99; ZNP-99 |
Gene ID | 23528 |
mRNA Refseq | NM_001281293 |
Protein Refseq | NP_001268222 |
MIM | 618703 |
UniProt ID | Q9Y2X9 |
◆ Recombinant Proteins | ||
ZNF281-138H | Recombinant Human ZNF281 Protein, His-tagged | +Inquiry |
ZNF281-139H | Recombinant Human ZNF281 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF281 Products
Required fields are marked with *
My Review for All ZNF281 Products
Required fields are marked with *
0
Inquiry Basket