Recombinant Human ZNF281 Protein, His-tagged

Cat.No. : ZNF281-138H
Product Overview : Recombinant Human ZNF281 Protein, fused to His-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of gene expression; negative regulation of transcription by RNA polymerase II; and positive regulation of transcription, DNA-templated. Located in nucleoplasm.
Form : Lyophilized from 0.22 um filtered solution in 50mM Tris, 300mM NaCl, pH8.5.
Molecular Mass : 27.4 kDa
AA Sequence : MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYLLEHHHHHH
Purity : >90%
Storage : For long term storage, the product should be stored at lyophilized state at -20 centigrade or lower. Please avoid repeated freeze-thaw cycles.
Concentration : 8.7mg/mL
Gene Name ZNF281 zinc finger protein 281 [ Homo sapiens (human) ]
Official Symbol ZNF281
Synonyms GZP1; ZBP99; ZBP-99; ZNP-99
Gene ID 23528
mRNA Refseq NM_001281293
Protein Refseq NP_001268222
MIM 618703
UniProt ID Q9Y2X9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF281 Products

Required fields are marked with *

My Review for All ZNF281 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon