Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Description : |
Enables DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in negative regulation of gene expression; negative regulation of transcription by RNA polymerase II; and positive regulation of transcription, DNA-templated. Located in nucleoplasm. |
Form : |
Lyophilized from 0.22 um filtered solution in 50mM Tris, 300mM NaCl, pH8.5. |
Molecular Mass : |
27.4 kDa |
AA Sequence : |
MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYLLEHHHHHH |
Purity : |
>90% |
Storage : |
For long term storage, the product should be stored at lyophilized state at -20 centigrade or lower. Please avoid repeated freeze-thaw cycles. |
Concentration : |
8.7mg/mL |