Recombinant Human ZNF384 Protein (1-245 aa), GST-tagged

• Cat.No.: ZNF384-1196H
• Product Overview: Recombinant Human ZNF384 Protein (1-245 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-245 aa
• Description: Transcription factor that binds the consensus DNA sequence [GC]AAAAA. Seems to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1 (By similarity).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 53.1 kDa
• AA Sequence: MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ZNF384 zinc finger protein 384 [ Homo sapiens ]
• Official Symbol: ZNF384
• Synonyms: ZNF384; CAGH1A; CIZ; NMP4; NP; CAGH1; ERDA2; TNRC1; FLJ59043
• Gene ID: 171017
• mRNA Refseq: NM_001039920
• Protein Refseq: NP_001035009
• MIM: 609951
• UniProt ID: Q8TF68