Recombinant Human ZNF384 Protein (1-245 aa), GST-tagged

Cat.No. : ZNF384-1196H
Product Overview : Recombinant Human ZNF384 Protein (1-245 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-245 aa
Description : Transcription factor that binds the consensus DNA sequence [GC]AAAAA. Seems to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1 (By similarity).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 53.1 kDa
AA Sequence : MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name ZNF384 zinc finger protein 384 [ Homo sapiens ]
Official Symbol ZNF384
Synonyms ZNF384; CAGH1A; CIZ; NMP4; NP; CAGH1; ERDA2; TNRC1; FLJ59043;
Gene ID 171017
mRNA Refseq NM_001039920
Protein Refseq NP_001035009
MIM 609951
UniProt ID Q8TF68

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF384 Products

Required fields are marked with *

My Review for All ZNF384 Products

Required fields are marked with *

0
cart-icon
0
compare icon