Recombinant Human ZNF384 Protein (1-245 aa), GST-tagged
Cat.No. : | ZNF384-1196H |
Product Overview : | Recombinant Human ZNF384 Protein (1-245 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-245 aa |
Description : | Transcription factor that binds the consensus DNA sequence [GC]AAAAA. Seems to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1 (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.1 kDa |
AA Sequence : | MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTFPISAPMIVSALPPGSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ZNF384 zinc finger protein 384 [ Homo sapiens ] |
Official Symbol | ZNF384 |
Synonyms | ZNF384; CAGH1A; CIZ; NMP4; NP; CAGH1; ERDA2; TNRC1; FLJ59043; |
Gene ID | 171017 |
mRNA Refseq | NM_001039920 |
Protein Refseq | NP_001035009 |
MIM | 609951 |
UniProt ID | Q8TF68 |
◆ Recombinant Proteins | ||
ZNF384-3535C | Recombinant Chicken ZNF384 | +Inquiry |
ZNF384-1501H | Recombinant Human ZNF384 protein, His & T7-tagged | +Inquiry |
ZNF384-1196H | Recombinant Human ZNF384 Protein (1-245 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF384 Products
Required fields are marked with *
My Review for All ZNF384 Products
Required fields are marked with *
0
Inquiry Basket