Recombinant Human ZNF473 protein, GST-tagged
| Cat.No. : | ZNF473-301199H |
| Product Overview : | Recombinant Human ZNF473 (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Glu204 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAEEFVTLKDVGMDFTLGDWEQLGLEQGDTFWDTALDNCQDLFLLDPPRPNLTSHPDGSEDLEPLAGGSPEATSPDVTETKNSPLMEDFFEEGFSQEIIEMLSKDGFWNSNFGEACIEDTWLDSLLGDPESLLRSDIATNGESPTECKSHELKRGLSPVSTVSTGEDSMVHNVSEKTLTPAKSKEYRGEFFSYSDHSQQDSVQE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | ZNF473 zinc finger protein 473 [ Homo sapiens ] |
| Official Symbol | ZNF473 |
| Synonyms | ZNF473; zinc finger protein 473; DKFZP434N043; HZFP100; KIAA1141; zfp-100; zinc finger protein ZFP100; zinc finger protein 100 homolog; ZN473; |
| Gene ID | 25888 |
| mRNA Refseq | NM_001006656 |
| Protein Refseq | NP_001006657 |
| UniProt ID | Q8WTR7 |
| ◆ Recombinant Proteins | ||
| ZFP473-18953M | Recombinant Mouse ZFP473 Protein | +Inquiry |
| ZNF473-582H | Recombinant Human ZNF473 Protein, His-tagged | +Inquiry |
| ZNF473-301199H | Recombinant Human ZNF473 protein, GST-tagged | +Inquiry |
| ZNF473-5333R | Recombinant Rhesus monkey ZNF473 Protein, His-tagged | +Inquiry |
| ZNF473-10429M | Recombinant Mouse ZNF473 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF473-2033HCL | Recombinant Human ZNF473 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF473 Products
Required fields are marked with *
My Review for All ZNF473 Products
Required fields are marked with *
