Recombinant Human ZPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZPLD1-2782H |
Product Overview : | ZPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_778226) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Glycoprotein which is a component of the gelatinous extracellular matrix in the cupulae of the vestibular organ. |
Molecular Mass : | 47.2 kDa |
AA Sequence : | MMLRFSMCRGNDEGFAMEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLFSGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYGNATSVQVGNISGYIDTPDPPTIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVRENNGTFVSTLNLLLYNDSTYNQQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZPLD1 zona pellucida-like domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | ZPLD1 |
Synonyms | ZPLD1; zona pellucida-like domain containing 1; zona pellucida-like domain-containing protein 1; ZP domain-containing protein 1; |
Gene ID | 131368 |
mRNA Refseq | NM_175056 |
Protein Refseq | NP_778226 |
MIM | 615915 |
UniProt ID | Q8TCW7 |
◆ Recombinant Proteins | ||
ZPLD1-10496M | Recombinant Mouse ZPLD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZPLD1-1114C | Recombinant Cynomolgus ZPLD1 Protein, His-tagged | +Inquiry |
ZPLD1-835H | Recombinant Human ZPLD1 Protein, MYC/DDK-tagged | +Inquiry |
ZPLD1-19229M | Recombinant Mouse ZPLD1 Protein | +Inquiry |
ZPLD1-2782H | Recombinant Human ZPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZPLD1 Products
Required fields are marked with *
My Review for All ZPLD1 Products
Required fields are marked with *
0
Inquiry Basket