Recombinant Human ZPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZPLD1-2782H
Product Overview : ZPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_778226) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Glycoprotein which is a component of the gelatinous extracellular matrix in the cupulae of the vestibular organ.
Molecular Mass : 47.2 kDa
AA Sequence : MMLRFSMCRGNDEGFAMEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLFSGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYGNATSVQVGNISGYIDTPDPPTIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVRENNGTFVSTLNLLLYNDSTYNQQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZPLD1 zona pellucida-like domain containing 1 [ Homo sapiens (human) ]
Official Symbol ZPLD1
Synonyms ZPLD1; zona pellucida-like domain containing 1; zona pellucida-like domain-containing protein 1; ZP domain-containing protein 1;
Gene ID 131368
mRNA Refseq NM_175056
Protein Refseq NP_778226
MIM 615915
UniProt ID Q8TCW7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZPLD1 Products

Required fields are marked with *

My Review for All ZPLD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon