Recombinant Human ZPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ZPLD1-2782H |
| Product Overview : | ZPLD1 MS Standard C13 and N15-labeled recombinant protein (NP_778226) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Glycoprotein which is a component of the gelatinous extracellular matrix in the cupulae of the vestibular organ. |
| Molecular Mass : | 47.2 kDa |
| AA Sequence : | MMLRFSMCRGNDEGFAMEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLFSGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYGNATSVQVGNISGYIDTPDPPTIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVRENNGTFVSTLNLLLYNDSTYNQQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ZPLD1 zona pellucida-like domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | ZPLD1 |
| Synonyms | ZPLD1; zona pellucida-like domain containing 1; zona pellucida-like domain-containing protein 1; ZP domain-containing protein 1; |
| Gene ID | 131368 |
| mRNA Refseq | NM_175056 |
| Protein Refseq | NP_778226 |
| MIM | 615915 |
| UniProt ID | Q8TCW7 |
| ◆ Recombinant Proteins | ||
| ZPLD1-2782H | Recombinant Human ZPLD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Zpld1-7125M | Recombinant Mouse Zpld1 Protein, Myc/DDK-tagged | +Inquiry |
| ZPLD1-835H | Recombinant Human ZPLD1 Protein, MYC/DDK-tagged | +Inquiry |
| ZPLD1-857C | Recombinant Cynomolgus Monkey ZPLD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZPLD1-10496M | Recombinant Mouse ZPLD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZPLD1 Products
Required fields are marked with *
My Review for All ZPLD1 Products
Required fields are marked with *




