Recombinant Human ZSCAN22 Protein, GST-tagged

Cat.No. : ZSCAN22-4831H
Product Overview : Human HKR2 partial ORF ( NP_862829.1, 196 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ZSCAN22 (Zinc Finger And SCAN Domain Containing 22) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZNF286A.
Molecular Mass : 36.63 kDa
AA Sequence : KSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ZSCAN22 zinc finger and SCAN domain containing 22 [ Homo sapiens ]
Official Symbol ZSCAN22
Synonyms ZSCAN22; zinc finger and SCAN domain containing 22; GLI Kruppel family member HKR2 , HKR2, zinc finger protein 50 , ZNF50; zinc finger and SCAN domain-containing protein 22; oncogene HKR2; zinc finger protein 50; GLI-Kruppel family member HKR2; krueppel-related zinc finger protein 2; HKR2; ZNF50; MGC126679; MGC138482;
Gene ID 342945
mRNA Refseq NM_181846
Protein Refseq NP_862829
MIM 165260
UniProt ID P10073

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZSCAN22 Products

Required fields are marked with *

My Review for All ZSCAN22 Products

Required fields are marked with *

0
cart-icon
0
compare icon