Recombinant Human ZSCAN22 Protein, GST-tagged
Cat.No. : | ZSCAN22-4831H |
Product Overview : | Human HKR2 partial ORF ( NP_862829.1, 196 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ZSCAN22 (Zinc Finger And SCAN Domain Containing 22) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZNF286A. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | KSVTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSAWPNLTSQEKPPSEDKFDLVDAYGTEPPYTYSGKRSSKCRECRKMFQSASALEAHQKTHSRKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ZSCAN22 zinc finger and SCAN domain containing 22 [ Homo sapiens ] |
Official Symbol | ZSCAN22 |
Synonyms | ZSCAN22; zinc finger and SCAN domain containing 22; GLI Kruppel family member HKR2 , HKR2, zinc finger protein 50 , ZNF50; zinc finger and SCAN domain-containing protein 22; oncogene HKR2; zinc finger protein 50; GLI-Kruppel family member HKR2; krueppel-related zinc finger protein 2; HKR2; ZNF50; MGC126679; MGC138482; |
Gene ID | 342945 |
mRNA Refseq | NM_181846 |
Protein Refseq | NP_862829 |
MIM | 165260 |
UniProt ID | P10073 |
◆ Recombinant Proteins | ||
ZSCAN22-374H | Recombinant Human ZSCAN22 Protein, His-tagged | +Inquiry |
ZSCAN22-4831H | Recombinant Human ZSCAN22 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZSCAN22 Products
Required fields are marked with *
My Review for All ZSCAN22 Products
Required fields are marked with *