Recombinant Lama glama IL4 protein, His-tagged
Cat.No. : | IL4-5362L |
Product Overview : | Recombinant Lama glama IL4 protein(Q865X5)(25-133aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lama glama |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-133aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAPKNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLERLKKIMKEKYSKC |
◆ Recombinant Proteins | ||
IL4-360H | Active Recombinant Human IL4, MIgG2a Fc-tagged | +Inquiry |
IL4-42H | Recombinant Human IL4 Protein | +Inquiry |
IL4-2484H | Recombinant Human IL4 Protein (Gly24-Ser153), C-His tagged | +Inquiry |
IL4-92H | Recombinant Human IL4 Protein | +Inquiry |
IL4-067H | Active Recombinant Human IL4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
0
Inquiry Basket