Recombinant Macaca mulatta CCL20 protein, GST-tagged
Cat.No. : | CCL20-15M |
Product Overview : | Recombinant Macaca mulatta CCL20 fused with GST tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | GST |
Form : | PBS, pH 7.4, 50% glycerol |
Molecular Mass : | 35.4kD |
AA Sequence : | ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM |
Purity : | >90%(SDS-PAGE) |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Gene Name | CCL20 C-C motif chemokine ligand 20 [ Macaca mulatta ] |
Official Symbol | CCL20 |
Synonyms | CCL20; C-C motif chemokine 20; chemokine CCL20/MIP-3ALPHA |
Gene ID | 574182 |
mRNA Refseq | NM_001032854 |
Protein Refseq | NP_001028026 |
Chromosome Location | chromosome: 12 |
Pathway | Chemokine signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Rheumatoid arthritis, conserved biosystem |
◆ Recombinant Proteins | ||
CCL20-512R | Recombinant Rhesus Macaque CCL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL20-11H | Recombinant Human CCL20 protein | +Inquiry |
CCL20-6008C | Recombinant Chicken CCL20 | +Inquiry |
CCL20-793M | Recombinant Mouse CCL20 Protein (Ala28-Met97) | +Inquiry |
CCL20-684R | Recombinant Rhesus monkey CCL20 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL20 Products
Required fields are marked with *
My Review for All CCL20 Products
Required fields are marked with *