"CCL20" Related Products

Expand
Expand
Expand

Recombinant Macaca mulatta CCL20 protein, GST-tagged

Cat.No.: CCL20-15M
Product Overview: Recombinant Macaca mulatta CCL20 fused with GST tag was expressed in E. coli.
Source: E. coli
Species: Macaca mulatta
Tag : GST
Form: PBS, pH 7.4, 50% glycerol
Molecular Mass: 35.4kD
AA Sequence: ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM
Purity: >90%(SDS-PAGE)
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name: CCL20 C-C motif chemokine ligand 20 [ Macaca mulatta ]
Official Symbol: CCL20
Synonyms: CCL20; C-C motif chemokine 20; chemokine CCL20/MIP-3ALPHA
Gene ID: 574182
mRNA Refseq: NM_001032854
Protein Refseq: NP_001028026
Chromosome Location: chromosome: 12
Pathway: Chemokine signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Rheumatoid arthritis, conserved biosystem

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.