Recombinant Macaca mulatta CCL20 protein, GST-tagged
| Cat.No. : | CCL20-15M |
| Product Overview : | Recombinant Macaca mulatta CCL20 fused with GST tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca mulatta |
| Source : | E.coli |
| Tag : | GST |
| Form : | PBS, pH 7.4, 50% glycerol |
| Molecular Mass : | 35.4kD |
| AA Sequence : | ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM |
| Purity : | >90%(SDS-PAGE) |
| Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Gene Name | CCL20 C-C motif chemokine ligand 20 [ Macaca mulatta ] |
| Official Symbol | CCL20 |
| Synonyms | CCL20; C-C motif chemokine 20; chemokine CCL20/MIP-3ALPHA |
| Gene ID | 574182 |
| mRNA Refseq | NM_001032854 |
| Protein Refseq | NP_001028026 |
| Chromosome Location | chromosome: 12 |
| Pathway | Chemokine signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Rheumatoid arthritis, conserved biosystem |
| ◆ Recombinant Proteins | ||
| CCL20-18M | Recombinant Mouse CCL20 Protein | +Inquiry |
| CCL20-870R | Recombinant Rat CCL20 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCL20-793M | Recombinant Mouse CCL20 Protein (Ala28-Met97) | +Inquiry |
| CCL20-2652R | Recombinant Rhesus macaque CCL20 protein, His-GST-tagged | +Inquiry |
| CCL20-166H | Recombinant Human CCL20, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL20 Products
Required fields are marked with *
My Review for All CCL20 Products
Required fields are marked with *
