Recombinant Mouse Adipoq Protein, His-tagged

Cat.No. : Adipoq-7153M
Product Overview : Recombinant mouse adiponectin, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 18-247
Description : Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Form : Liquid
Molecular Mass : 27 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Purity : > 90 % > / = 90% by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store at -20 centigrade. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL
Storage Buffer : 20 mM Tris pH 8.0, 1 mM DTT, 10 % Glycerol
Gene Name Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ]
Official Symbol Adipoq
Synonyms Adipoq; adiponectin, C1Q and collagen domain containing; a; Ad; ap; APN; Acd; Acr; Acdc; Adid; GBP2; adip; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d
Gene ID 11450
mRNA Refseq NM_009605
Protein Refseq NP_033735
UniProt ID Q60994

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Adipoq Products

Required fields are marked with *

My Review for All Adipoq Products

Required fields are marked with *

0

Inquiry Basket

cartIcon