Recombinant Mouse Adipoq Protein, His-tagged
Cat.No. : | Adipoq-7153M |
Product Overview : | Recombinant mouse adiponectin, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-247 |
Description : | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. |
Form : | Liquid |
Molecular Mass : | 27 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
Purity : | > 90 % > / = 90% by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store at -20 centigrade. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL |
Storage Buffer : | 20 mM Tris pH 8.0, 1 mM DTT, 10 % Glycerol |
Gene Name | Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ] |
Official Symbol | Adipoq |
Synonyms | Adipoq; adiponectin, C1Q and collagen domain containing; a; Ad; ap; APN; Acd; Acr; Acdc; Adid; GBP2; adip; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d |
Gene ID | 11450 |
mRNA Refseq | NM_009605 |
Protein Refseq | NP_033735 |
UniProt ID | Q60994 |
◆ Recombinant Proteins | ||
ADIPOQ-392H | Recombinant Human ADIPOQ Protein, GST-tagged | +Inquiry |
ADIPOQ-1098H | Recombinant Human ADIPOQ protein, hFc-tagged | +Inquiry |
Adipoq-502R | Active Recombinant Rat Adipoq Protein | +Inquiry |
ADIPOQ-4956H | Active Recombinant Human Adiponectin, C1Q And Collagen Domain Containing | +Inquiry |
ADIPOQ-087H | Recombinant Human ADIPOQ Protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adipoq Products
Required fields are marked with *
My Review for All Adipoq Products
Required fields are marked with *