Recombinant Mouse Amelx protein, His&Myc-tagged
Cat.No. : | Amelx-633M |
Product Overview : | Recombinant Mouse Amelx protein(P63277)(17-210aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 17-210a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MPLPPHPGSPGYINLSYEKSHSQAINTDRTALVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD |
Gene Name | Amelx amelogenin X chromosome [ Mus musculus ] |
Official Symbol | Amelx |
Synonyms | AMELX; amelogenin X chromosome; amelogenin, X isoform; enamel matrix protein; leucine-rich amelogenin peptide; .; Amg; ALGN; AMGL; AMGX; Amel; LRAP; M100888; Rgsc888; |
Gene ID | 11704 |
mRNA Refseq | NM_001081978 |
Protein Refseq | NP_001075447 |
◆ Recombinant Proteins | ||
AMELX-7077H | Recombinant Human AMELX, His-tagged | +Inquiry |
AMELX-7079H | Recombinant Human AMELX, His-tagged | +Inquiry |
AMELX-305R | Recombinant Rat AMELX Protein, His (Fc)-Avi-tagged | +Inquiry |
AMELX-12H | Recombinant Human AMELX protein, His-tagged | +Inquiry |
AMELX-1026HF | Recombinant Full Length Human AMELX Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMELX-70HCL | Recombinant Human AMELX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Amelx Products
Required fields are marked with *
My Review for All Amelx Products
Required fields are marked with *