Recombinant Mouse Amelx protein, His&Myc-tagged

• Cat.No.: Amelx-633M
• Product Overview: Recombinant Mouse Amelx protein(P63277)(17-210aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 17-210a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MPLPPHPGSPGYINLSYEKSHSQAINTDRTALVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD

Gene Information

• Gene Name: Amelx amelogenin X chromosome [ Mus musculus ]
• Official Symbol: Amelx
• Synonyms: AMELX; amelogenin X chromosome; amelogenin, X isoform; enamel matrix protein; leucine-rich amelogenin peptide; .; Amg; ALGN; AMGL; AMGX; Amel; LRAP; M100888; Rgsc888
• Gene ID: 11704
• mRNA Refseq: NM_001081978
• Protein Refseq: NP_001075447