Recombinant Mouse Amh protein, His-tagged
| Cat.No. : | Amh-5636M | 
| Product Overview : | Recombinant Mouse Amh protein(P27106)(450-552aa), fused with N-terminal His tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 450-552aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 15.4 kDa | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| AA Sequence : | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC | 
| Gene Name | Amh anti-Mullerian hormone [ Mus musculus ] | 
| Official Symbol | Amh | 
| Synonyms | AMH; anti-Mullerian hormone; muellerian-inhibiting factor; anti-Muellerian hormone; Mullerian inhibiting substance; muellerian-inhibiting substance; MIS; | 
| Gene ID | 11705 | 
| mRNA Refseq | NM_007445 | 
| Protein Refseq | NP_031471 | 
| ◆ Recombinant Proteins | ||
| AMH-1854Z | Recombinant Zebrafish AMH | +Inquiry | 
| AMH-0010H | Recombinant Human AMH Protein | +Inquiry | 
| AMH-892H | Active Recombinant Human AMH protein, His-tagged | +Inquiry | 
| AMH-306R | Recombinant Rat AMH Protein, His (Fc)-Avi-tagged | +Inquiry | 
| AMH-383H | Active Recombinant Human Anti-Mullerian Hormone | +Inquiry | 
| ◆ Native Proteins | ||
| AMH-8822HFL | Recombinant Full Length Human AMH Protein, Fc tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Amh Products
Required fields are marked with *
My Review for All Amh Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            