Recombinant Mouse Amh protein, His-tagged
Cat.No. : | Amh-5636M |
Product Overview : | Recombinant Mouse Amh protein(P27106)(450-552aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 450-552aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC |
Gene Name | Amh anti-Mullerian hormone [ Mus musculus ] |
Official Symbol | Amh |
Synonyms | AMH; anti-Mullerian hormone; muellerian-inhibiting factor; anti-Muellerian hormone; Mullerian inhibiting substance; muellerian-inhibiting substance; MIS; |
Gene ID | 11705 |
mRNA Refseq | NM_007445 |
Protein Refseq | NP_031471 |
◆ Recombinant Proteins | ||
AMH-1154H | Recombinant Human AMH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AMH-2081B | Recombinant Bovine AMH Protein (25-575 aa), His-tagged | +Inquiry |
AMH-0010H | Recombinant Human AMH Protein | +Inquiry |
AMH-306R | Recombinant Rat AMH Protein, His (Fc)-Avi-tagged | +Inquiry |
AMH-35H | Recombinant Human AMH Full Length protein | +Inquiry |
◆ Native Proteins | ||
AMH-8822HFL | Recombinant Full Length Human AMH Protein, Fc tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Amh Products
Required fields are marked with *
My Review for All Amh Products
Required fields are marked with *