Recombinant Mouse ANG4 Protein (25-144 aa), His-SUMO-tagged
Cat.No. : | ANG4-1853M |
Product Overview : | Recombinant Mouse ANG4 Protein (25-144 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His&SUMO |
Protein Length : | 25-144 aa |
Description : | Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 29.9 kDa |
AA Sequence : | QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | Ang4; |
UniProt ID | Q3TMQ6 |
◆ Recombinant Proteins | ||
ANG4-3994C | Recombinant Chicken ANG4 | +Inquiry |
ANG4-1629M | Recombinant Mouse ANG4 Protein | +Inquiry |
Ang4-5772M | Recombinant Mouse Ang4 protein, His-sumostar-tagged | +Inquiry |
ANG4-1853M | Recombinant Mouse ANG4 Protein (25-144 aa), His-SUMO-tagged | +Inquiry |
ANG4-526M | Recombinant Mouse ANG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANG4 Products
Required fields are marked with *
My Review for All ANG4 Products
Required fields are marked with *
0
Inquiry Basket