Recombinant Rat Apoe protein, His-tagged
| Cat.No. : | Apoe-543R |
| Product Overview : | Recombinant Rat Apoe protein(P02650)(19-312aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-312aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQ |
| Gene Name | Apoe apolipoprotein E [ Rattus norvegicus ] |
| Official Symbol | Apoe |
| Synonyms | APOE; apolipoprotein E; apo-E; APOEA; |
| Gene ID | 25728 |
| mRNA Refseq | NM_138828 |
| Protein Refseq | NP_620183 |
| ◆ Recombinant Proteins | ||
| Apoe-25M | Recombinant Mouse Apoe protein, His-tagged | +Inquiry |
| APOE-695H | Recombinant Human Apolipoprotein E, E2 Isoform | +Inquiry |
| APOE-694H | Recombinant Human Apolipoprotein E, E4 Isoform | +Inquiry |
| APOE-227P | Recombinant Pig APOE Protein, His-tagged | +Inquiry |
| APOE4-2869H | Recombinant Human APOE4 protein, His&Trx-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ApoE-3560H | Native Human ApoE | +Inquiry |
| APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
| APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOE-8780HCL | Recombinant Human APOE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoe Products
Required fields are marked with *
My Review for All Apoe Products
Required fields are marked with *
