Recombinant Mouse ASGR2 Protein (80-301 aa), His-Myc-tagged
Cat.No. : | ASGR2-2450M |
Product Overview : | Recombinant Mouse ASGR2 Protein (80-301 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 80-301 aa |
Description : | Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 29.9 kDa |
AA Sequence : | QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Asgr2 asialoglycoprotein receptor 2 [ Mus musculus ] |
Official Symbol | ASGR2 |
Synonyms | ASGR2; HL-2; mHL-2; ASGPR 2; ASGP-R 2; hepatic lectin 2; Asgr; ASGPR2; Asgr-2; |
Gene ID | 11890 |
mRNA Refseq | NM_007493 |
Protein Refseq | NP_031519 |
UniProt ID | P24721 |
◆ Recombinant Proteins | ||
ASGR2-6239H | Recombinant Human ASGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ASGR2-26516TH | Recombinant Human ASGR2 | +Inquiry |
ASGR2-2557M | Recombinant Mouse ASGR2 protein, His-SUMO & Myc-tagged | +Inquiry |
ASGR2-197H | Recombinant Human ASGR2 Protein, His-tagged | +Inquiry |
RFL-17112MF | Recombinant Full Length Mouse Asialoglycoprotein Receptor 2(Asgr2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASGR2-1492HCL | Recombinant Human ASGR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASGR2 Products
Required fields are marked with *
My Review for All ASGR2 Products
Required fields are marked with *
0
Inquiry Basket