Recombinant Mouse ASGR2 Protein (80-301 aa), His-Myc-tagged

• Cat.No.: ASGR2-2450M
• Product Overview: Recombinant Mouse ASGR2 Protein (80-301 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 80-301 aa
• Description: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 29.9 kDa
• AA Sequence: QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Asgr2 asialoglycoprotein receptor 2 [ Mus musculus ]
• Official Symbol: ASGR2
• Synonyms: ASGR2; HL-2; mHL-2; ASGPR 2; ASGP-R 2; hepatic lectin 2; Asgr; ASGPR2; Asgr-2
• Gene ID: 11890
• mRNA Refseq: NM_007493
• Protein Refseq: NP_031519
• UniProt ID: P24721