Species : |
Human |
Source : |
Wheat Germ |
Tag : |
Non |
Protein Length : |
287 amino acids |
Description : |
This gene encodes a subunit of the asialoglycoprotein receptor. This receptor is a transmembrane protein that plays a critical role in serum glycoprotein homeostasis by mediating the endocytosis and lysosomal degradation of glycoproteins with exposed terminal galactose or N-acetylgalactosamine residues. The asialoglycoprotein receptor may facilitate hepatic infection by multiple viruses including hepatitis B, and is also a target for liver-specific drug delivery. The asialoglycoprotein receptor is a hetero-oligomeric protein composed of major and minor subunits, which are encoded by different genes. The protein encoded by this gene is the less abundant minor subunit. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Weight : |
57.310kDa inclusive of tags |
Tissue specificity : |
Expressed exclusively in hepatic parenchymal cells. |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
MAKDFQDIQQLSSEENDHPFHQGPPPAQPLAQRLCSMVCF SLLALSFNILLLVVICVTGSQSAQLQAELRSLKEAFSNFS SSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHD ALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWVEH QGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQRFI VQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAVTQP DNWRGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKRR NATGEVA |
Sequence Similarities : |
Contains 1 C-type lectin domain. |