Recombinant Mouse Bcl2 protein
| Cat.No. : | Bcl2-6743M |
| Product Overview : | Recombinant Mouse Bcl2 protein(P10417)(5-205aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 5-205aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22.8 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP |
| Gene Name | Bcl2 B cell leukemia/lymphoma 2 [ Mus musculus ] |
| Official Symbol | Bcl2 |
| Synonyms | BCL2; B cell leukemia/lymphoma 2; apoptosis regulator Bcl-2; B-cell leukemia/lymphoma 2; Bcl-2; AW986256; C430015F12Rik; D630044D05Rik; D830018M01Rik; |
| Gene ID | 12043 |
| mRNA Refseq | NM_009741 |
| Protein Refseq | NP_033871 |
| ◆ Recombinant Proteins | ||
| BCL2-76H | Recombinant Human BCL2 protein | +Inquiry |
| Bcl2-3582M | Recombinant Full Length Mouse Bcl2 Protein, His tagged | +Inquiry |
| BCL2-7856H | Recombinant Human BCL2 protein, His-tagged | +Inquiry |
| BCL2-2469H | Recombinant Human BCL2 Protein, MYC/DDK-tagged | +Inquiry |
| BCL2-1588HF | Recombinant Full Length Human BCL2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL2-327HKCL | Human BCL2 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bcl2 Products
Required fields are marked with *
My Review for All Bcl2 Products
Required fields are marked with *



