Recombinant Mouse Bcl2 protein

• Cat.No.: Bcl2-6743M
• Product Overview: Recombinant Mouse Bcl2 protein(P10417)(5-205aa) was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 5-205aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 22.8 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Gene Information

• Gene Name: Bcl2 B cell leukemia/lymphoma 2 [ Mus musculus ]
• Official Symbol: Bcl2
• Synonyms: BCL2; B cell leukemia/lymphoma 2; apoptosis regulator Bcl-2; B-cell leukemia/lymphoma 2; Bcl-2; AW986256; C430015F12Rik; D630044D05Rik; D830018M01Rik
• Gene ID: 12043
• mRNA Refseq: NM_009741
• Protein Refseq: NP_033871