Recombinant Mouse Bcl2 protein, GST-tagged
Cat.No. : | Bcl2-6443M |
Product Overview : | Recombinant Mouse Bcl2 protein(1-236 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 1-236 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
Gene Name | Bcl2 B cell leukemia/lymphoma 2 [ Mus musculus ] |
Official Symbol | Bcl2 |
Synonyms | BCL2; B cell leukemia/lymphoma 2; apoptosis regulator Bcl-2; B-cell leukemia/lymphoma 2; Bcl-2; AW986256; C430015F12Rik; D630044D05Rik; D830018M01Rik; |
Gene ID | 12043 |
mRNA Refseq | NM_009741 |
Protein Refseq | NP_033871 |
◆ Recombinant Proteins | ||
Bcl2-3582M | Recombinant Mouse Bcl2, His-tagged | +Inquiry |
BCL2-4343H | Recombinant Human BCL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BCL2-7857H | Recombinant Human BCL2 protein, GST-tagged | +Inquiry |
BCL2-5361H | Recombinant Human B-cell CLL/lymphoma 2, His-tagged | +Inquiry |
BCL2-4222H | Recombinant Human (minus BH3 domain) B-Cell CLL/Lymphoma 2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2 Products
Required fields are marked with *
My Review for All BCL2 Products
Required fields are marked with *