Recombinant Mouse Bcl2 protein, GST-tagged

Cat.No. : Bcl2-6443M
Product Overview : Recombinant Mouse Bcl2 protein(1-236 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Tag : GST
Protein Length : 1-236 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Gene Name Bcl2 B cell leukemia/lymphoma 2 [ Mus musculus ]
Official Symbol Bcl2
Synonyms BCL2; B cell leukemia/lymphoma 2; apoptosis regulator Bcl-2; B-cell leukemia/lymphoma 2; Bcl-2; AW986256; C430015F12Rik; D630044D05Rik; D830018M01Rik;
Gene ID 12043
mRNA Refseq NM_009741
Protein Refseq NP_033871

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BCL2 Products

Required fields are marked with *

My Review for All BCL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon