Recombinant Mouse Bcl2 protein, His-tagged
Cat.No. : | Bcl2-2580M |
Product Overview : | Recombinant Mouse Bcl2 protein(P10417)(5-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 5-205aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.7 kDa |
AA Sequence : | GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Bcl2 B cell leukemia/lymphoma 2 [ Mus musculus ] |
Official Symbol | Bcl2 |
Synonyms | BCL2; B cell leukemia/lymphoma 2; apoptosis regulator Bcl-2; B-cell leukemia/lymphoma 2; Bcl-2; AW986256; C430015F12Rik; D630044D05Rik; D830018M01Rik; |
Gene ID | 12043 |
mRNA Refseq | NM_009741 |
Protein Refseq | NP_033871 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bcl2 Products
Required fields are marked with *
My Review for All Bcl2 Products
Required fields are marked with *