"BMP4" Related Products

Expand
Expand
Expand

Recombinant Mouse BMP4 Protein, His-MBP-tagged

Cat.No.: BMP4-267H
Product Overview: Mouse Bmp4 (P21275, 303 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.
Source: E. coli
Species: Mouse
Tag : His-MBP
Form: Lyophilized from solutions contain no sodiun azide nor carrier protein
Bio-activity: Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.
AA Sequence: KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Endotoxin: Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
Purity: 98%
Storage: Store at -20 centigrade.Reconstitute in 10 mM Citric Acid to a concentration of 0.1-1.0 mg/mL. Do not vortex. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name: Bmp4 bone morphogenetic protein 4 [ Mus musculus ]
Official Symbol: Bmp4
Synonyms: BMP4; bone morphogenetic protein 4; BMP-2B; bone morphogenetic protein 2B; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1;
Gene ID: 12159
mRNA Refseq: NM_007554
Protein Refseq: NP_031580

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.