Recombinant Mouse BTLA Protein

Cat.No. : BTLA-612M
Product Overview : Recombinant Mouse BTLA protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Protein Length : 305
Description : Enables signaling receptor activity. Acts upstream of or within immune response-regulating cell surface receptor signaling pathway; negative regulation of B cell proliferation; and negative regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Orthologous to human BTLA (B and T lymphocyte associated).
Form : Lyophilized
Molecular Mass : 18.6 kDa
AA Sequence : MKTVPAMLGTPRLFREFFILHLGLWSILCEKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPGRTWLLYTLLPLGALLLLLACVCLLCFLKRIQGKEKKPSDLAGRDTNLVDIPASSRTNHQALPSGTGIYDNDPWSSMQDESELTISLQSERNNQGIVYASLNHCVIGRNPRQENNMQEAPTEYASICVRS
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Btla B and T lymphocyte associated [ Mus musculus (house mouse) ]
Official Symbol BTLA
Synonyms BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; A630002H24; MGC124217; MGC124218;
Gene ID 208154
mRNA Refseq NM_001037719
Protein Refseq NP_001032808
UniProt ID Q7TSA3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTLA Products

Required fields are marked with *

My Review for All BTLA Products

Required fields are marked with *

0
cart-icon
0
compare icon