Recombinant Mouse Btla Protein, hIgG/His-tagged

Cat.No. : Btla-03M
Product Overview : Recombinant mouse BTLA, fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc&His
Description : Biased expression in spleen adult (RPKM 9.3), mammary gland adult (RPKM 3.5) and 3 other tissues.
Form : Liquid
Molecular Mass : 44.1 kDa
AA Sequence : EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Btla B and T lymphocyte associated [ Mus musculus (house mouse) ]
Official Symbol Btla
Synonyms Btla; B and T lymphocyte associated; A630002H24; B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein
Gene ID 208154
mRNA Refseq NM_177584
Protein Refseq NP_808252
UniProt ID Q32MV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Btla Products

Required fields are marked with *

My Review for All Btla Products

Required fields are marked with *

0
cart-icon