Recombinant Mouse C1QA Protein (23-245 aa), His-tagged

• Cat.No.: C1QA-1345M
• Product Overview: Recombinant Mouse C1QA Protein (23-245 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 23-245 aa
• Description: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complent syst. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.6 kDa
• AA Sequence: EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: C1qa complement component 1, q subcomponent, alpha polypeptide [ Mus musculus ]
• Official Symbol: C1QA
• Synonyms: C1QA; C1q; AI255395
• Gene ID: 12259
• mRNA Refseq: NM_007572
• Protein Refseq: NP_031598
• UniProt ID: P98086